ELFa(\44 444hGhGPPP =PPQtd/lib/ld-uClibc.so.0ap.O4%C*` i9g&dU<\Z7TLj8@^bQW12'hafS;+YcRnlAeo:mX- ,I5"N!$_ / ?3(=DE>6K0FVB ]MG[)# PJHkz$PS0g<0H,T0` l0Sf x,, ,,̓DؓP SWS , 0,#8 0D@P`A\Mh,TtD\$cXp0x,}$Ȕ0"Se S<X )\P P@,(S @$ 4X@ L,X$d4p%|,,,3,80?ESĕ0ZЕ,gܕ KSm$t,~ DA@ $0,<0q HTS`lxDSy X  O "ؖ 4`h\#\R; 0 ,,,e8kD08P,libgcc_s.so.1mallocabort__deregister_frame_infostrlen_Jv_RegisterClasses__register_frame_inforaisefreelibc.so.0strcpyioctlstdoutgeteuidinet_ptonmemmove__ctype_bexecvegetpidfgetsmemcpyputsdup2tolowergetuidsystemisattyoptargstrtollvsnprintfsocketselectmempcpyfreeaddrinfo__fgetc_unlockedgetnameinfoacceptstrrchrcallocgai_strerrorfprintfbindntohlif_nametoindexsetsockoptoptindstdinwaitdprintfmktimelstatferrorsignalopenlogin6addr_loopbackstrlcpy__cmsg_nxthdrstrncpyunlinkhtonlsendtoreallocmemcmplistenforksscanffread__uClibc_mainstrdupgettimeofdayfopengetoptlocaltimememsetstrlcatfclosentohssyslogstrcmpfgetcstderrsetlogmasksrandomgetaddrinfofwritehtonsstrptime__errno_locationexitatoifilenodaemon__assertstrchr__data_startrecvmsggetsockname_edata__bss_start__bss_start____bss_end____end___endGCC_3.0P&y ~SS SS,S.S8SVPPPPQQQ Q Q Q QQ Q$Q(Q,Q0Q4Q8QQ?Q@QAQBQCQDQEQFQGQHQJQKQLQMQOQPQQQRRTRURW RXRYRZR]R^ R_$R`(Ra,Rb0Rc4Rd8Re00 0 KSST T4TXT\T -LM  00 x00 0S\\!0e700 L0 0 0 0 0 0 0 0S%  00S  >7  087000 000 0hh 0$70S 00 0S 00 0 KS|TTTTXTT -L0M080 60S (0S ||&6xh0S T\&6P60HH&p0S 0&6,,u0S &60S %6L0S %600K 0 0 0 0 0 0 0 0,0 0(0 0$0 000 00K4KL 0h00 0S 0%6i40 4040 0 4 40S|$w6S4 8K00 00S B00c0h$^6:P4 8K00)1 00S )00J0$E6!3 8K00) 00S 0010P#,63 8K00) 00S 000H#6$3 40400 b0S 000"5405 ( 2 20S 000$"500K 0 0 0 0 0 0 0 0,0 0(0 0$0 00K4K 000 0S 0X!540 401 !104010Sl!5d1 `10 P1n0S 8!5_(0s U00v0d q5M0s C00d0 _5; KTTTU$U,0K( K$K K0S 0L0 3$0S ,0K( K 0 0 0 0 0 0 0  0 0 00 400 00 0040P 0 40P 00 40P || .000 0S0<0 0S 0S 4F0<0 <0 K$\\ -LM 0 0S 0 0S 0 000 -000   K8\H\ -L M 0D00 00S 0 0,0@@ -00 000 0S00 0 K`\p\ -LM 00 0S 0S ,00 0 00 0 K(T p-LM,M<#0CK<#0C K0000 :K0C0C,0 ,0 0 0 0 , 00<#0CK040S P040 <#0CK080DD%G-, 04080<0@00,0 000 40 000 80 000 0 000<#0C K040S+, 04080<0@0,0 000 40 000 80 000 0 000/, 04080<0@<#0CK080\0,0 000 40 000 80 000 0 0000$0 0 :K0C0C@  00s 000h ,,00*@:K0C40C00$P 0+&,>00 $ 0H0,00,00|0S #&&,00S ,00 ,00 |00s |0 ,0 , 00$0D0(0 (000S (00 ,00R(00(0 (00S(0 ,0 ( ,00,00S=$ ,0@0$0 $0@0 0"0S X"%00 $0@00p$ 0S \"%00 |$ 040$ 0<0$0H0,0 $0H , 00$$D!$!b$0D00S]$0 0+J00 $0 0ܖ0\0 $0 0!20b01= Q0X0 $0$0ǖ0d0 $0$0!20b01= <0`0 \0KT KYJT d0RT d0R P `0Rd0KT KlK FJ0h0 h0l0 p0l0h 0 8 0Q%$0 l0K*I00 0K$_8_H_U\_t_TT_____0T``8`\``l[[` -LM  0D00 0 0R"0S00 000 0S00 0 K -LlMX \ ` d0 \ 04080<0W04X0H0 H0S&$x H0<0D0 D0S D0S D0S D0S D0S D0SX0,00S,0&$ x d00S&$0x0 wd00S%$@x@ ld0!0S %$x ^H0H0\` d00S Xp%$ x MD0SX0,00S d00S (%$0x0 :d0<0L0 L0 0 04k#0$p$L00L0 L0Sd0T0S 0<0 d0T0@0 @0 0 0< @00@0 <00<0 @0Sd0\0S 040 d0\080 800$4 80080 40040 80Sd0d0S 0,0 d0d000 00 0 0, 00000 ,00,0 00Sd0D0S 0$0 d0D0(0 (0 0 0D$ (00(0 $00$0 (0Sd0L0S 00 d0L0 0 00  00 0 000 0SD0S9   d0t p t rp0sd0  PX-G X0 X00S$"#$0T0 0P0 T0S0!#1T0 X0 T0KGd0l h l rh0sP!#D0S d0$ d0H0H00X  0Z?d0, d0H0H00X  0N?X0D0S X0D00S X0DD00 0e#X0D0Dd nHHD0ST U#00S 0000@x@ x0K`8_`H_t_TT__`aa(aDaXata,aaa b@bXb0T$T|R -LM  000 08 0R00 000 0S00 0 K p-L(M$ ( , 00 0 0 00 00080 80s 80S 00000S 44#"000S 000 #"000S 000""$0000S ""00$0P`000  0S Xh""t$0 0 0 0S 00 00R000 0 0R 00 0 0 0 &0S$ !"P00000 000 R50 0 0S000l!x"9 00Pl!q"$  0 0 R0S 008!c"$( 000000000 00, 0CR0S K"00  D"000 ="0S $00s T 2"040 000$ 0@$00 $0 040 40Kp|bbbbb(cHcdcccccdLd -LM  0H00 0S0 0 0 0 0 0 0 0 000 0s 0S u0 0 z0<0S!!0 0 o0<0S00 0 0 0 c0 0S b!0x|!!0 0 U0 0SQ0S 0 004K0C 00 0S (10PT!''081 I 0 c0R (10 !081 6 >K0C 0 000 00 0 0S(18#808#(08#80c8#8 41000 010S 081 081 81 Kfg@gdg -LM  T00 0Spp 00 0T h 00 0<0 0L00L 0P 00 0 Kgg -LM 00@/00LL!0Q000 0S 0 0B@00S 0 0000 00 00 0000D00 000 0 00 _0000S 00US00 0S0H0S 0H0FDKggh -LM 00S 0 0000 0P 0 00000S 000L00 0S K -LM   200 0S  ,0 0 0 0 0 0 0  00 00 00 0 000 0 0    0 K -L M 00 0S00 0 00 0 K Mp-LLMD L H 01,K00t1@K00D0S LL!D0 ` H,0KL K q@0K l,K@0K0 0}LK;0@L0 H@ 50@0AP!`"\P X` L0\`S H0X St| ^0`0 LK0S@T0 P@ P`P P`VP RT0SP`P `0Kph$h4 |0R.6z,00C!SZ7p7|BCC8:`:;Ct;C7=CCC>CCp>8?`?>(@C??>>@A??(0SI (0p0 0l0 p0KF0DD-0p K0S+ -7(0S- (0p0 0l0 p0K*0,00p K0S ,(0S@0K  @0K 040>0KC4=0K>0K 040 (,0<0> K00S+(000S(0S ( ?00$0 000 00 Ar0K  r0K 04B0<0 <0C0@P+~040< K00S r0K 04.0+i040< K00S*Z00000 000 0 $0R(0S00\x*E00s 0\*=p00 0 j(0Sq@0K  D@0K 040@0KC4?0K@0K 04)00s )E@0K 04 0 =(000 0 00SC 0 (0 (00%(0 S,00s  )*00 0 000 00 0 000 00 0 000 00  000 04d((0 0C0 00S Z0S00 0 0S00C 0 000 0 00S'0 000 00 000 00  00 0 000   0 c0 000 00 00 0& 0Y00&R(0S 00~(0q0 0 00S 0 (0 N (00f0L0(, Q0sn \0\0(, G0sd R0|0(, =0sZ H00(, 30sP >00(, )0sF 40D0(, Z0s< *0T0(, P0s2 0t0(, F0s( 00(, <0s 00(, 20s 0d0(, (0s  (00ST0Kx  P00`0 L00\0 H0 0X0 `\0X 0  $ 00$0` K00S `0#`0K0h0 h0Kd0 x00(0 00hK, 00S0$0` KhK 00Sh0Kh0K(0SD0K  tD00D0 D0"RD ?0RD0\"H?D0 0 r0st"6iD0@ 0 @c(00SiT0Kx  0[4 =0[8 <0[<00`0 ;0[L0 d0K G0K 0 xL d0K0}d0K0L0d `0 $ 0I d0K 00S d0K0L0d `0 ,@$ 0/ d0K0y00 0K0 00K   0'0Sd0KK 0`0S0K'0K#0S  @  00X`#0 00S0K  l0H00 h0C00 0K 0K00K00 0 " 0 0K 010S 0K0p0 0 Hh" 0 v00 0K0 00K   00Sv0KK 00S0Kh0KU0S 0S 0S 0S F @ C 00`h!0| <00SB*0K  &0K 04$0&0KC4%0K&0K 04V 0![ *0K0 00S &0K 04 I *0K0 00S 00 0 0RM00 T\ 0/ 0KE00 0Knknno$oPooookkop -L(M  ( $0 (0K0 0 04 000 00KC40K0 04 000 00KC40K0 04 000 00KC40K0 0400KC40K 0K 00K 00K 00K 040  00 K0KC4=0K!0 00<0KC4;0K008#8 0:0KC490K!0 0080KC470K008#8 060KC450K!0 0040KC430K0 08#8 0>0KC4=0K!0 00<0KC4;0K008#8 0:0KC490K!0 0080KC470K008#8 060KC450K!0 0040KC430K0 00 00[0K 40 00Z0K 80 00Y0K 0 00X0K000 00W0K 40 00V0K 80 00U0K 0 00T0K0$00S0K0 _0K 0 S0 0T0 00g0K 40 00f0K 80 00e0K 0 00d0K0060 00c0K 40 00b0K 80 00a0K 0 00`0K0w K0 0 0 04Z0.0KC4-0K00 0,  00 0 Krrr -LM  0 0 0$0 0(0 000 0,00<00CS9n(nHntnnn ?$0 u;0,08 ?$0 u;0,00 ?$0 u<00,0  0(0% '<0$0 :=,0 '<0$0 :=,0 ?$0 0(0 0<0000 0  Krr p-L,M8 80<0S 0u0 80 80<0S68040S20u00v0@!("+0w0@$0 @ 80$0vP`80$0v0@$ K v0@ 0u0@,0 (@ S0}tu0?Crv0@!("+0nw0@$0 @ 8040S80$0]vP`80$0Wv0@$ K v0@ 0u0@,0 (@ 80 00?vP`80 09v0@$ K mv0@ 0iu0@,0 (@ 80,0S* 80,0v0@, K w0S80,0vP`80,0 v0@$ K >v0@ 0:u0@,0 (@ ,Kw 80 80 0ht040 80 0!20b01= t000 80 40K&800 800804 80 00  0Kps$s -L M  0 0 000 0 00SLL 00 0 000 00 0 KXs`s -L M  0 00R 0 000 I 00 0 K -LM 00S 00 00 00 -L M $ ( 0S 44! 00,0 C(0S  !(00,0 80K!0S S00t0 o0,0 $00 048~<00 00 000 000 $0 K i$00 K a0,0 ,0 K|ssss -LM  80CRڐ20 00C&S񟗒 w,w8wDwPw\whwtwwxwwwwwwwwwxwxxx4x@xXxdxpx|x(xLxxxxxxxx10 o10 l10 i10 f10 c10 `10 ]10 Z10 W10 T10 Q10 Nx10 Kp10 Hh10 E`10 BX10 ?P10 <H10 9@10 6810 3010 0(10 - 10 *10 '10 $10 !10 00 00 00 00 00 00 00 00   000 0 Ksssst(t4tDtPt`tptttttttttuu(u,u@uLuTuduuuuuuuuuvvx$v -LM 0S10 ?00C S3 zz$z0zK 0Cr00 H10x8 0 49! K 00t8 0 0p8 00v>l8 l8 0l8 00h8 00d8 00`8 0S \ 0\8 lh80d`8 0T80\;K 0C 0C0xpt(p80S H0X8 @X ;K 0C 0C0P,T(X83 KHLwSwkw x -LhMT X \ `0 T0h0 h0S h0S 20 <00  20 <600 0d0 v  {00 0S 00;0!60d0 `00K P0K P0KX P0K3 0S0000!X0 0d0 7\0 00K0`0 0 @00 00K 0S 00 X00 | 00d0 \0f00`00X000< 00d0 d0 K4x8x(x@xdxxx -LhMp @0T  0t0 4l0Kp 0S 000 0t0 00 T 0R lt p00t0 \0: S 0t0 \0:0 , p00t0 t0Kxxxy$y -L(M, ,0(0 (000S(0@@00a00&0Z80$0 $0S(00&L$0 0 0 0 0 0 0 0 0 0 0 0 0 0 6 $0 &$00(000 $0 $00S% ]$ 00$ 00$0 $0 $ 0 0$0 $0$ (0 00 <00 S)8`$$`$$$ 50S 50 00$ 0(00$ . 0S00$ $ 0S00$  0S l40S `40 000H$ 0$00 $0 40S 40 00# 000 $0 $00S$00Sڨ30 $00 0l# 0wl30S `30 000H# 0h$00S $30 00# 0Y00 0 000 $0 $00S"E$00 0 00/S p"9$00!0 000C 0 00o000 P200 0 000S 000 0S0S 10 00 0! 0V00s 00s 0 00R h10 00x100l! 0;$0 ,0000 $0, $0,0S!$$0,$000 0 00 00| 0000 0S(00(0 (0S>000 800 ( 00000 00KDyXytyzy,Ryyyz z 0  0000 0 0 0S!8' 0 000 0- 00 $00 0` 0000 0S$00$0 $0S0,0 0,0 ,0K||z|}0}X}t}}}z}~@{\zzxzzD~l~ -LCM M@ 0 0 @480  0,0 ,0S800&,0 0 0 0 0 0 0 0 t6 ,0 d&,00800Z0 ,0 ,00S800&w ( $ 0 0 80 00 00&0CSH,00S 50 800 0% 000| ,0 ,00S<P%tA,00\ ,0 (0s$0s 50 00$ 0Z0( $ $0S $0S$0S$0S40 00d|$ 0= ,00S P40 800 08$ 0+q00# 040 40S$C>K0C+ǽC>K0C4+g&000 00S 30 00t# 04400#0 ,0 ,00S H#,0 0C>K0C 0 ,0 % 0S 20 800 0" 000 0 0 20 800 0T" 0000 0S,00S800 @"u(0s $0s800"h( ,0 ,00S800!Z,0  0SK F0SE C>K 0C90s S00t0(l!o<C>K 0C00  00 < 90S $ 20S    +0S L嵼00 <$0Sh 0> , 0080080 80SJ D$  0S .0D4 D4K~~z~~4Lx4TtȀԀ܀ -LM  00 00ü0S00 000 0S00 0 K -L M 00 00 0S00#0 0 0 0 0 x3 0 h#00 00 0 0 0000W0 0 00S00"0 00 p00"0CSYؤ<00s 20 00 0x" 0Q00 0 J0 0s H20 00 0(" 0n800 0 100s 10 00 0! 0U00 0 10 00h! 0C d10 00 00P! 05B000 0S00(0 (0S (0S (0s 00 (00S  00S | 0 0s 0 000s 00000 0S 0$0 0$0 $0K0z\Lx,RȂ -L M10!0Sj10!0Sa10!0SX10!0SOx10pp!m0SF`10XX!d0S=H10@4!0S4,10$$!R0S+10 !0S"00 @0S00 0S0   R0S0    0K،zzzЌzČz܌{{{Ȍ{ {̌({SR 0-L M  $ 0S X10S L10 0088! 0)0(0 B 00  0 00 400  00S 0P0 @00 @$00  00(0 00  0B0SLT $00(0 000 0S0(0 (0K0,Ry @ -L0M$ ( , $0S 10S 1$0 00! 0000 h( 00( (0 $00 Z000R00 0Sdh!,0000 M厺0 000C0  0000 偺00 0 0K( 00S 00 0 0,00  0z 0K000  0K( 00S dp ,0f 0K000 0K000 0S000 00 K,R\yp -L$M( , 00 (-00 0SZ00 00C0 0e0SN0ie0 000 0S<0$0 0=0$0 $0 K(<T| -L4010 !0010!0010A 0000Z 00" 00 00 00 00 00 00| t 00h d00`X 00L H00D0 800hzzzzzzzzzR@{ -L Mp400  0,0 0000H00P0} 0400D0S 0D0᯸ 0D0 0X0 0\0 0`0300 0 00Y0S 000 0S0S] 0 0, 0 00 0H 00> 00S 0 0000 0$ 0 000 000T 0 0T 00 0T 0 00 0S0 04 0 0D  000(0S 0(0 0X 0(0 0\ 0(0 0` 0 8,0 0,0000 0S_10!0010S !10 1 1 !001021 t1 p!00h10G\1 P1 L!00D <<800,$$   0 00m0 0 00Kzhzzzzzzzz`zzz{X{p{{x {({RP<{@{ -L M 00 "000 00z000 0500S 00j0,0S 0,0b`00 0S K -L M 0 00 000 00IG00 0S00U K -LM &00S 0 0000 0 0 00000S 00S @@ 0000 0S K -L M 00 "000 0000 000 0S 0 00 0S 0 0޶ܶ00 0S K -L M 00 000 00ƶ00¶00ᾶ弶00 0S K -L M 00 000 娶00 0S K -L,M$ ( , ,00 000CSyL̽44Ծ4444444444$040 40S 40S (00 (0 f(0 0 (0 `000%$0^000 ]$0S 000dd%$0P000 OP5 0000 0S$50 00 0% 04000 3(0(0S 40 (00 0$ 0 000 ( 0(0$0S >00t 00 0SD40 00 0($ 0000 00S 0 0000 3 0 000 00(0$ 0 (0$ 00 (0$ 000\\#$0$0S >00D 00 0S30 00 0" 0000 00S 0 0000 2 0 000 00(0$ 0 (0$ 00 (0$ 000,,"$0{000CS4       0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 "0 0 !0 0  0 0 $0S #(00 K00S 00!0)(00 K0t0S !000 000|| $0t00 00 0Dl 0000 000 0Si000 00K zDhh܅ 0-L@M4 8 < @0 @00K0S0S0tt#0D0  00K0@00 00K00R@000 00K000R@000 00K000R @00 0 00K0 00R @00OP@0@00K0G @800 X\"000K00S 00K0@0@ @0T 00K0@0@ @0T 00K00!`0D0 a<00 K400S" <0S00K0008004@! 0B 00K0800 ! 040D0 5,0s$ 00s 0 ,0R<0S 00K000 0 00K00Xp 0D0 <00 K40O0S0D0 0D0 D0K0@L`܆4 -LM   000 0 0R0 0R0 0 000 0S0 0 0 K -L M 00 0S 00 000 0 00R0 000 90S00 000 0S00 0 Kz -LM  00 00K0S00 000 0S00 0 K -LM  000 20$ 00R)00 000R!000 0000R000 0000R 00 0 00 00R0 00 000 0S00 0 K -LM   000 0 0R00 媲0S0 0R0 0 000 0S0 0 0 Kz -LM 00 00"S 0S 000C0"S 00 00 0S00 0 0C0  00 C0000 0 K -L M ! 0S 10S 1 000! 0V 00 M00 00 0 00 00 S 000 000 10 00! 040S0S 00 00 0 0x 0000 0S00`x gp0 0 ` 00000 0S0$0 0$0 $0 Kl|,Ṙ@{ -L M PP >00 000 006400 0S K| -LM $ 00 00 30S #00#30#00#003 ?0R?30 30#00000 00,0S 00000 0S0S00000 00S 0 0000 0 0 00020 C2 00 00 0S"0(0 0 0 0 <ڰ00 0S04"v0< R 000 0  000 0 00 0S10 *0 0 00S!|K00 y0SC$00S $00 0 0 0 0S!_.$0 0$ $0 0(  000 0 00S 0 00 0 00 |00x00 l0 00\h 20(0 0S &0S '0(0 (0 KR0{8{$<zdh -L M 00 H100 00 00R 00 000 ደ0S 000 0S0S, 00S 0 0000 0 0 000x0 0 00S X0 00 @0 8 00 (00000 00 0 K0{ -LM  00 0S 0S0 0 ]0V@00P0@0HH!0 00c0S0;@00500 0~0 0 .(㣯00 0S p0 0  0 0 00S`h __0 0 0 00 00 0 0K脈z -L M 00 0S00 % 02000 000SX` 0!00 000 0S , 000 0 KȈԈ<{܈ -LM$ ( $0S (0S0,0 [$00ll!$0 K0@ 0K8*0S. 0K0S* 0K@e0@ @`0T 0K@X0@ @S0T 0Ku0 (0 0K0,0  0Kd0\d 0K$0 0Kw0S( 0,0 ,0K0<L -LM  0S 0S00 O0@000((!0y00E0S-00=0S%)0S 00S 0@0@ @ݮ0T 0@ծ0@ @Ю0T 00 0@00 $ 0700 0Kd| -LM  00  0 00Q  0 00Q00 00 000 0S00 0 K -LM 00 0000 000S00C0 0S K -LDM( , 0 40 000 00 ,00s ,00s ,0 ,00R,00x,0 ,0,00 0ll% 00@0 Q0S\0ۭ00 0S$(%0@0 @0 0 0 0 0 0 0 0 0 0 0 0  (00 00 l40 d4 0 \4 0 T400 0 0 0 0 0  00$0 0(00( 0,  0 0(0, 00 0S[8s00 0S#@0@0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0, 0,0 0  0,0 00000 04  000, 0 0, 00 0, 00 㪭 0$ ,0 0 ,0 0 0S 2<0 2<0 ,00,0,0 ,00 0!<00 0S" 0S 0$000 0 400u0S400(L!, Q000 0S0 080 80S 80s *0(0S& 0(0H !0(0S 0( 0(0S\ vi0@0 0 0$0 0 0 0( $0KE 0@0 @0 K踉ȉ`T$,4`H -LM   000 400 000R)000 0000R000 0000R00 0 00 00R 0S 0 00R0 0 000 0S0 0 0 K -L M 000 00! 00(0S 0(0 00S 0 0000 04 0 000ج0000 0S00S 0 0000, 00,00 000弬 K蜊 -L M 00 0(0S00 00 0 K -L$M( (0$0 00 T00 $0(0 0 ) 0$ 0R 0$ 00b00 000 000 0 0R 0 0 c, 0,0 ,00 0s  0R*00 00 0 0S0 K -L M 00 00S 0 0000 0, 0 00080(00 0S= K -L(M$ ( , 00 $00 00 0 0 0K0 0(00 0 0K0j0S, 000 0S=00 0S  00 0 0K( O0S 0K0 0 00 000 ,000 D00040 0K0S 040 40 K -LM 0 0S TT 㮫00S 00 00000 « K̊܊ -LM 00 00`0 00pp 00,000 0,000 0(0S 0(0V 00 K -LM   0 00 &00 0S u0S 00` 0 0S 008 0嶪0S  K,DHx -L0M, 0 4 0$0 Hq0$0 $0S#>080 $0H $ 400$ 0 0 $00 000 40 0 $0( 4000S DH#$0( 4000S$0( 4000S 0040 400 0" 0$00 0 0000 00 0000 00 000 000C0 000 0S400`0(0 (0K00 4000c S010 40 00 00C0 00 000C0 00C0 0S0S 00C0 0 0 0000 040@ Q $0(0$0$ , 00 40 00$04 0 0000C0 400 S01 0R40@$0,0 $0(0$"0S$ 00,04 $0 ,04 $00$ ,04 080 $0S $P080 80K蜋ԋ -LM  000 0 0,0(0000 00 K 0-L@M< @ D H0 @00 0 D0P < 0 0 $0,0 ,0S 00S 0 00R 0 000\\& 0H00<D,  0?000 00S ,00,0 00% 0q00S ,00,0 00% 00[ 0(00 00L0 L0S L0S% L0S= q,0(0 0 (0 00,000500 D00Sc 00Q0$00$ 0T,0$0 0 00,400D  00SD 0020`t$}9<P 0 @0 0 04f0@0($0h000S 000S0 0 04S0000m000 00# 0J0)x#C000 0Su00,0S 00,0 00,00S0000A000 00 # 00K00 0S 000SQ00,0S 00,0 0S 00,0 00,000 <00 00 0S 0s0 0 00 00 000S0s0 0001S0 00 00 000R00 010!00 00 0000t! 0000S00 0000<h! 00 0000 010!00 00 0000! 000 0s000S$ 000Q000S0 00 000Sh 0 00 080 040 00 80KP0 00 00 0 0SKK0,8X`P`|Ѝԍ, -L M  0S00 $000Ss 00 000Sdd 800 00 00 000@00 00000 0K -LM( (000-(00 0000$ 0 (00S (00S $ڧ(00S. (000S (00 (0000(00 (000P0(00 (0000(000S (00 (00(00Χ( 00(00S (00(0 000 0S" 00(0 0 0 (0 0 00(0 0 0 0 0 0SP`"㺦00 0S 4"~0 0 0 0 0 0 0  00 000P 0 0P 00 0P 0 (0$0\0S Ld!RI(00 0$0 (0 0 0 (000 (0,0S (0,00S (0,0@(0, (0$0K 00S  ) (000S (000P 0H 0H0SXx   040( 00:0S _K8Hd̎  -LM 0,0S 0,0 0,00S00000 00 0 K,` -LM 0P00 000 000 00 0S000 0S K -L M$ $000$00 00# 0$0 000 0S" 00$0 0 0 $0 0 00$0 0 0 0 0 0SHT"j0 $0$0e0S  "[uゥ00 0S!Oi0 0 0 0 0 0 0 $00 0 0 $0 00 $000 $0,0S $0,00S $0,0$0,0 K 0 0S !- 000P 0 0P 00 0P  040$000S $000% 0H 0H0SHd 0(0 0S <0(0 (0 K8D̎\ -LM 000 0 00 00000 00! 000S 0 0000 0 0 0000$000S 00V00S. 000S 00 000000 000P000 0000000S 00 0000i 000,0S 0,0 0S 0,0 0,0000S 000MK Kx 0-L@M< <0$0 $000PP$00 @$00e0@0%0'$00S. $000S $00 $0000$00 $000P0$00 $0000$000S $00 $00$00$ 00$00L0 L0S L0S ($ 0000 $0 $00R*$0 $0 00cH0 0H0 H080 040 $0 80K$ 0000 $00$00#0D0 $0 00 0 0S# 00$0 0 0 $0 0 00$0 0 0p  0 0 0S4D#㱣00 0S#~0 0 0 0 0 0 0   00 00 0P 0 0P 00  0P $00S 0 $0$0O0S  8"Ez$00 000 $0 0,0 $00(0 $00@0 @0S @0S =$0,0S9 $0,00S4 $0,0@$0, $000K 00S# Tp!G$0,0S $0,00S $0,0@$0, $000K 00S  ( 040  $000S $000 0H 0H0Sl $ 00$000CS $00D0  0S !0D0 D0K0蜏ď̎܏ -L0M $ ( ,0 00 0K0S 44"4 ,0 0(  00 0SN4㸢00 0S !0K 4 h0 0 0 0 0 0 0 0 0 0 0 0 0  00 00(0 0 (0 00 (0  (0000 0$0,0 0 ,0 0  $0 00K$( 0S d 0 \000 < 00 0 0 0 004 40 K8@H -LM   000 00 0R00 0R0 0 000 0S0 0 0 K -L M 00 0S 0S (00  00 00 0 K\`d -L M 00 0S 0S:0S 400 ,00 $00 00 0 Khpxd -L 00 0輌T{R -LM  㹡00 0S! 90 0 0 0 0 0 0S jF 00 00 t0 h0 0 00S H0 008 00 (00 0 K耐R -LM 000S 00 000000 000000& 00 -LM  0K㻡 0 0K 0 T00R 0 <00R  0 $00R 00 KT{ -LM 0K㓡!1100 4000 0 0R 0 0R0 0R 0 000S 0 $10R 0 10R 0 00R00 00 0S0 00R0 00R$ 0 0R l0 0R X0 0RP 00D0 <0  0K $ h0$0 $0KT{RD{ -L M 0K0 0R 0 0R0 0R PP ]L 00@0 80 00 K 30 KȐܐL{ -LM   0 0000  =9?0R  000 00 0 0=9C =C 00 000 0 K -LM   0 000c0 0S  000 00 c0 0=9 = 00 000c C0 K -LM  0l0 0K 0 0 0 0 0 0 0 0S 00S00 00CSH`x0K /ß0K /彟0K l/巟 0K X/屟00@/@?<Ÿ0h0 0d0 00 0|0 0x0 0`0 0\0 0X0 0T0 0P0 0L0 0H0 0D0 0t0 0$080 h00h0 80080 80St h00t0 0,080 d00d0 80080 80St d00t0 0T080 000 80080 80S0S  t00t0 0\080 80 x00x0 80080 80Sx0S  t00t0 0d080 |00|0 80080 80S|0S  t00t0 0D080 `00`0 80080 80S`0S  t00t0 0L080 80 \00\0 80080 80S\0S  t00t0 0t080 X00X0 80080 80SX0S  t00t0 0|080 80 T00T0 80080 80ST0S  t00t0 0080 P00P0 80080 80SP0S  t00t0 0080 80 L00L0 80080 80SL0S  t00t0 0080 H00H0 80080 80SH0S  t00t0 0080 80 D00D0 80080 80SD0S  t00t0 t01᝞0@0 @0S|*j00 t0!@000 01 @0@0K000S00 000 R l)G0l0 [0SJ 0"10b0a0p0 01 @0@p0[000<0 <0S00 000 R X)0l0 3p <0Ȟp0<x)$90T080 80 00,0 p0<, Ip0<, ~I80080 80S|0SJ |0"10b0a0p0 01 @0@p0 000<0 <0S00 000 R ((0l0 p <0zp0<@(7ϝ0d080 80 0j0(0 p0<( 5Ip0< 0I80080 80Sx0S? x00p0 01 @0@p0ĝ000<0 <0S00 000 R p '0l0 p <01p0<'6冝0\080 800p <Hp0< H80080 80S`0SJ `0"10b0a0p0 01 @0@p0|000<0 <0S00 000 R P%@0l0 Tp <0p0<%5>0D080 80 0ٿ0$0 p0<$ Hp0< H80080 80S\0S? \00p0 01 @0@p03000<0 <0S00 000 R ,$0l0 p <0㠝p0<$40L080 800p <aHp0< \H80080 80SX0SJ X0"10b0a0p0 01 @0@p0000<0 <0S00 000 R  #0l0 p <0Xp0<#3孜0t080 80 0H0 0 p0<  Hp0<l H80080 80ST0S? T00p0 01 @0@p0ᢜ000<0 <0S00 000 R "f0l0 zp <0p0<"p2d0|080 800p <Gp0<` G80080 80SP0SJ P0"10b0a0p0 01 @0@p0Z000<0 <0S00 000 R !0l0 2p <0ǜp0<t!X10080 80 0㷾00 p0< Gp0<( }G80080 80SL0Sn L00p0 01 @0@p0000<0 <0S00 000 R5 p 0l0 $4DTtS<0ShSRR@SPSH`SttSSГ4S8 8HL\HTTp <0Op0<l 0夛0080 800p <Gp0< G80080 80SH0SJ H0"10b0a0p0 01 @0@p0᚛000<0 <0S00 000 R 8d!^0l0 rp <0p0<!1\0080 80 000 p0< Fp0< F80080 80SD0S? D00p0 01 @0@p0Q000<0 <0S00 000 R \"0l0 )p <0㾛p0<"20080 800p <Fp0< zF80080 80S00 0$080 100 00 01 @0@ 000 0KK8 0000<0 <0S00 000 R 0l0 0 m0 h80080 80S00 0,080 01 @0@ 000 8-000<0 <0S00 000 R 0l0 80080 80S#040 40S b00ლ0$~0l0 40S" 0Kޚ000 0 40R 00S00S C00d04D%_HT%0Y0Sa l00 00 |%M00 01 @000%@01 @000 000 0R&+a0S  &0!060S<00 0s .+(0S0K@ ښ000&Қ60S 60S 00 01 @000ߚ000 t0R@֚l00 0K -L0M8 00 20K s80S20K l!l1ř80SS20K D!H1廙20K088!8020K(L00 0S20K!70S 0K 0,0S20K %0K 0400KC40K0K 04S80St囙p噙 0K 04S80SD卙0S  KHԔ 4 -LM  00 00 0S ?00S0K 0K)0K=$00   000Kx {0S\\ 0r0S8< 0i0S ę K謕ĕȕRR 0-L,M( , 0 40 1 0 0*㥙 !110 ,0(0$0 T$0080 80S) 80S C ʙ0 0@ ę0Zc$00〻 $0$0 0(!0Ҙ$00 00 $0 0 40 00 !$0 0 04S 坙0 0@ 嗙0c$0 0 040 0媘00 xx $00$0 $0S 100 0S48 (00K0\{4R$(0D 0-L M( , 1 0 0* !1q10 ,0(0$0 G$0000 00S 00S 6 @0 0P :0Jc$0000!0K00 !$0 0 04S  0 0@ 0c$0 0 040 0-00 xx $00$0 $0S 崘00 0S48 (00K0\{4Rt$(`0| -LM$ $00 0S "$00(0 d00 0Shl"0d ㆘ 000 0 $n0 0 00S"l0Sg 0H00H 0L  0P00P 0T  0X0 0\0 0`0 0K,0S w00ᘗ0HT!? 00 ,00$M0S!0 0S 0 0 04 S0 00 00@0@ @0T 0 0000 0S 0"t0 0 d 000(0 00S 00LJ0(0 (0K蘖̖ -LM 00ᓗ00 0S0@00'00LL 0 0 0 00  00 000 0 0K -L M d000 00—0S00 000 0S00 0 K -L M X000 0 0R00 000 0S00 0 K -LM   0 0 0 0R:00 00  ̖0 0 0 00 0 K -L8M8 < @ 40K< @018000 80080 0S 0 S 0 S 0 S 0 S 40K20S 0D0 40K0S 0D0 0 <0 cD D0 K -LM   0  00 00 00 00 0 0 K -L M  00S0,0  400 0S0,0 0 2c  100 0 00S0 0@S 00@S0,0 00@S00@S 0,0 00@S000S 0,0 x00@S000S 0,0 l00@S 00@S0$0 0$0 $0(0 0(0 (00 0S  0000@S 0000@S 000 01 00C200000K002 00C100000K003 0000000K 0K0S 0,0 00S 0 0R0,0 0 0 c0  000,0 ,0 K  -LM 00S00 00S 00 00 0 K -L M 00S00 0K0s00 0 0R00 00 0 K -LM  0 0S 00 '0 0R00 00 00K f 0K 0K K 00 K ,00 0 K -LM  0 0S 00 :0 0R00 2 0 0K  00 㙕00 00K  0K }0K K00  00 K ߔ00 0 K -LM  0X0@ e0@S0K0K 0X 0K0X0  Ე0P0K6@ C00 0C K000X 0000 C K 0 00000 0?Sڬ0P K@  K -LM 00X0@   -L M   0  K -LLMT X T0X"P0K\@ 00 0C K00T0X 0000 C K 0 00000 0?ST0NT0P K@ T0X }T0XT K -LM $ 0K 0K$ ㉔0 K -L M  00 000$0000000$000 0 000 000 00C0 0S K -LM  @00 800 000 (0 0 00 00#EgܺvT2 -LM X X -LM  00$0 000 0 0000 0 000  0! 0 #000$ 05C$0 $0U9C$0 $nA$ $  B$ $< 0$0  0!$0 #0000 040 09C0 A   B a:$ 00 $ 0!0  #0000 0 30 090     7 00 $ 0!0$ #0 000 05C 0 0#:C 0 A   B a5 0 0  0! 0 #0000$ 0*5C$0 $0?:C$0 $QA$ $ < 0$0 0"$ 0 #0000 0G40 080   *  a:$ 00 $ 0!0  #0000 0*30 090 a    7 00 $ 0!0$ #0000 04 0 0F8 0    a5 0 0  0! 0 #0 000$ 0i4$0 $05$0 $&$ $  $ $< 0$0  0!$0 #0$000 0>C0 0]3C0 A  b:$00 $  0" 0  #0(000 0);C0 0O0C0 7 00 $ 0!0$ #0,000 04 0 08C 0 A   B a5 0 0  0! 0 #00000$ 0k4$0 $0 6$0 $$ $ " $ $< 0$0  0!$0 #04000 07C0 0;C0 A   B a:$ 00 $ 0!0  #08000 040 0y80 C    7 00 $ 0!0$ #0<000 0> 0 0R3 0 m  b50 0 0" 0 #0000$ 04$0 $08$0 $$ $ " $ $= 0$0 $ 0!0  #0000 010 050   @  ;$ 00 $ 0! 0$ #0,000 050 0y90 i    a9 00  0!$0 #000 0Y5C 0 0:C 0 A   B a6 0 0  0!0 #0000$ 04$0 $0/8$0 $A$ $  $ $= 0$0 $ 0!0  #0(000 070 0Q=0   ;$00  $0" 0$ #0<000 0630 080     a9 00  0!$0 #0000 0:3 0 0 7C 0 CA   B a6 0 0  0!0 #0$000$ 05$0 $09$0 $$ $  $ $= 0$0 $ 0!0  #08000 05C0 0:C0 A   B ;$ 00 $ 0! 0$ #0 000 06C0 0:C0 A   B a9 00  0!$0 #0 000 0E4 0 0Z8 0 S  - a6 0 0  0!0 #04000$ 04$0 $08$0 $$ $  $ $= 0$0 $ 0!0  #0000 016C0 0;C0 A  ;$00  $0" 0$ #0000 030 0 6C0 A  ' B a9 00  0!$0 #00000 04 0 09 0 2   a6 0 0  0! #0000$ 09C$0 $0k>C$0 $A$ $ b> 0$0 $  0" #0 000 040 0q80     :$ 00 $ 0!  #0,000 0m40 080 a  "  a8 00  0!$ #08000 07C 0 0;C 0 A  40 0 0" #0000$ 0)3$0 $08$0 $$ $ D $ $a> 0$0 $ 0! #0000 030 0!8C0 A   B :$ 00 $ 0!  #0000 0%5C0 0K:C0 JA  b800  0"$ #0(000 04 0 05C 0 CA   B 4 0 0  0! #04000$ 0)4$0 $07C$0 $A$ $ : B$ $a> 0$0 $ 0! #000 0U5C0 0{9C0 A   B :$ 00 $ 0!  #0 000 0530 080     a8 00  0!$ #0000 05 0 0: 0     4 0 0  0! #0$000$ 04$0 $057$0 $ $ $ 9 $ $a> 0$0 $ 0! #00000 040 09C0 &A   B :$ 00 $ 0!  #0<000 02C0 0]8C0 A  b800  0"$ #0000 013 0 0+7 0 V  e 4 0 0 0 0 #000$ 0=3$0 $0)8$0 $$ $  $ $a= 0$0 0$ 0  #0000 030 08C0 iA  b;$00 00$ #08000 040 0%70   '  8 00 $0 0 #0000 0?3 0 08 0    9 5 0 0 0 0 #00000$ 0f4$0 $0)7C$0 $A$ $ = B$ $a= 0$0 0$ 0  #0 000 040 0390     a;$ 00 0 0$ #0(000 06C0 0.=C0 A  800 $ 00 #0000 04 0 0!7 0 ]   5 0 0 0 0 #0 000$ 02$0 $0W8C$0 $A$ $  B$ $a= 0$0 0$ 0  #0<000 06C0 0;C0 A  b;$00 00$ #0000 040 090   800 $ 00 #04000 0N4 0 0: 0    5 0 0 0 0 #0000$ 06C$0 $029C$0 $_A$ $  B$ $a= 0$0 0$ 0  #0,000 040 08C0 7A   B a;$ 00 0 0$ #0000 0+40 0 7C0 A   B 8 00 $0 0 #0$000 0Q5C 0 098C 0 A  / B 5 0 0 00$ 0 0 000 000 000000 0 0000 K -LM   000  0 0 0 0R*00 0 0?0@0c0  0R 00 00c@0  }C00 00c@0  p00] 00 000  00c0 00 @ T00A 000@00 0@0C0 0?S00  8 K -LM  00?00 00 000  00000 070c0 0S00 ᭌ00 00J000 800 0 ᘌ0000!0P 00!00> 0T  00'0 0 ۋX p K -LHM@ D H L0 080 00 40K 0 0 0 0 0 0 0 000 0,0 0(0 40K8K@D 0[00 0S ً0$$"0P0 80 8080 0 ᪋00 0S I00j0!eZ0<0 0 s 00 04  0 4 000 0 p0 00 \0 P00 D0 00 坊00 0 KԘh8\\` -LM 00ᅊ削800S(( [00 C0 \Й -L M0 t20,0 ,00(0 ,00"00!,000R300S ,0 ,040$0 ,0 $,040c0 ,00 $0 0 0S 00?0!:J 0S!2B,0$ 0 ,0$,0$,0 4RK,04 S,0 00 ,0 D0 0408#8͉0 ,0 $,0$,0 4R,0ē,0 ,0 4 00 00S ,0 4 S,0 4 ,00S ,0 ,000,0 @0 ,0 ,000,F(0,0 ,0Sh0K`$H -LM  000 000 002 000 02 0!0 0R000 000 0S 000 K` -L0 040 40S 40s 0S-0<0 ,0$0S& 0$0)!0$0S 0$ 0$0S\ W^0<0 0 0 0 00 0$ 0K&0<0 <0 Khx@xxy4zԚܚ(|  -LM  000 +00 000R 000 0000R000 0000R 00 0 00 00R00 000 0S00 0 K -LM 00㜩0 0$0S 0$000S 0 0000( 00(00 000000 Ƈ0 K0< -L M 00 0$0S00 00 0 K -L$M( (0$0 00 \00 $0$0 0 ) 0 0R 0 00b00 000 000 0 0R 0 0 c, 0,0 ,00 0s  0R*00 00 0 0S0 K -L M 00 00S 0 0000 0( 0 000T0$00 0SE K -L(M$ ( , 00 $00 00 0 0 0K0 0$00 0 0K0r0S, 000 0SE00 0S  00 0 0K( W0S 0K0 0 00 000 ,000 D00040 0K 0S 040 40 K{ -LM 0 0S TT 㶆00S 00 00000 ʆ KTh -LM 00 00h0ll 0(000 0(000 0$0S 0$0b00 K| -L0M0 4 4000 ,0K 0 0 0 0 0 0 0 ,0K+ K0$K040,000 00,K 00 00 K -LMDD U@< <00S 00 00 0蠛l, -Ll -LM 0S00 $ۧ0 &0S ͧ0PX 00 @ 30S 00 00 0 K贛ěl̛ -LM 0S 㦧0@@ <0S 㘧0 ěl -LM 0S ョ0hh οd00 0Ss0(0 徿0 000  0 Kěl -LM x0S00l -LM 00 00 00 0 000 000 000 0S0 K -LM  00 00 0  0S00 K -LM   0 0S 0S 0S0$0 *01~0 0 00S0$0 00 0 01 00000  0R: 00 00  0 00$0 $0 K -L M 0SA 00 )0 01000 00S 0 0000 00000S 000 0100S000 0  S:000 0 0 0 K -LM  00 00 0S 0S0$0 \00 0S0$0 R0 0 0 0 ۃ0 0 00S0$0 900   ᶃ00 00!000 0 010 0 00S 0 010 000 01 000 010 0 0$0 $0 K -LM  0S 0S00 $%00 0S00 00S 0 0000 00000S 00:800 0 K -LM  0S 0S0 0 *00 00/00 0 01000 0 000S 0 0 000 0S0 0 0 K -L0 -LM 000 0 00 000 ܃00 0S 00 K -L4M4 8 400S〃0 40 0$0 808#8 0KC40K0 0K K00 4000 00K00K 0 0 0 00K/ K4000K$ K0 00 000 0sh00S 0 K -LM|  020K010K|0S [x5000 0 80CR0000#11 c 0#110 0@0 0僂0@0 @0S6 010K@0\0 00X0 |0 0S |00D0 |0 0D0 T0Kx0 0t0 \0Kp0 0l0 0h0 0d0 0`0 |00x K &0$0 $0s00S $080 80SP0S`0 0Sd 00 sD00H0 H00 0 H 0H0 H0SD 0000 80CR 0000 000#11 c 0#110 00  0 @0R00 000 000 0@0 00000 10[S @  00 0[00 0S @00 010K"000@0\0 00X0 |00 |0 |0S0,0 80(0 @0<0 B<0 0 |00R,<0 |00R&,00,0 <00 04S020K4<00 04S<000 <00#S] 00`X 000c0Y<000 (00b(0 <0000 <00<0 (0S<00S<0 (0R,0S. 8000H0 H0S2 H 00H0 8@0 \0 H0 8 H0 |0 H0 |0 0S| H0 0|0 H00| H0020[0#0S10[S @" 10[S @00 0 KS -LM 000 00ށ 00 K -LM  + 0 00S0K 0 0 0 0K K 00 K 40S 0$0  00 00 KK ́0S0 0 0$0 $0 K -LM   0 00 301 000s01 0 000S0!20 00C0!20 0000$0 01 00 0R0$0 000   0R$0 K -LM ?K000|0 0t0 0S 000K[0S 0K0S0t0 000 0K0S0t0 00 00 00 00l0 00S 00p0 wp0 0 0Rbp0 0 0R\p00 04Sp p00 04SDp00h0 h00d0 p00 0C`0 $d0 040C\0 d00 04S|0\ 0|0 #d0 040 `00b`0 d0 0400 d00d0 `0S d0 04Sd0 04 `0R000 p00 04S000 p000 l00bl0 p0000 p00p0 l0Sp00Sp0 l0R{000 0Sj0 0SV 00!2 |0000 0S0t0 C0100#11 c 0#110 00 01 % 00!20 00x0 00 00 00T0 00S 00X0 0P0 X0 0 0RX0 0 0RX00 04S X00 04S=X00L0 L00H0 X00 0CD0 L000C  0o0P0 P0!20 0 L000 H00@0 H0 040C<0 H00 040CS$d8<0SP0!20 00 0 P0!20 00(0@ < P0!20 0 <00'0P0!20 0 L00 0P0!20 0L00 04$0C4%0P0!20 0P0!20 000 0<0SP0!20 00 T0U P0!20 00`0@ < ~P0!20 0 <00_0P0!20 0 L00X0P0!20 0L00 04\0C4]0P0!20 0P0!20 00T00?<00S;P0!20 0P0!20 00p00P0!20 00p0@< ~0 00P0!20 0 x00< x00x0 P0!20 000@ < =~H0 040 D00bD0 H0 0400 H00H0 D0SXH0 04SRH0 04 D0RIX00 04SBX0080 80040 X000C00 00P0 P0!20 0@8000C  00!20 0000P0SP0!20 00CP0!20 000000 *400,0 40 040C(0 400 040CSꤜԞġP0!20 00 0S P0!20 0P0!20 00T00P0!20 00T0$0 P0!20 0P0!20 000 0P0!20 000$0 800$ 0C408000 R 0 S 2(0S$00, ( e}(0S$00, ( Y},0@}0@ @}0T ,00S,0000S$08   (0S~$00, ( 2}uP0!20 00 0S/ P0!20 0P0!20 00TP0!20 0P0!20 00T00P0!20 000 }P0!20 0P0!20 000 0P0!20 00 8000C408000 R 0 S H(0SP0!20 00 0, ( |(0SP0!20 00$0, ( |,0@}0@ @}0T ,00S,0000SP0!20 0 800400t(0SP0!20 000, ( v|P0!20 000S P0!20 00T0 |P0!20 0P0!20 00T00P0!20 00 8000C408000 R 0 S D(0SyP0!20 00X0, ( '|j(0SgP0!20 00\0, ( |,0@|0@ @z|0T ,00SH,0000SBP0!20 0 800l07(0S4P0!20 00V0, ( {%(00S P0!20 0P0!20 00p00P0!20 00p0,( {0 00{40 040 000b00 40 0400 40040 00S 40 04S40 04 00RP0!20 000SP0!20 0@8000C  00!20 0000P0!20 00 0S P0!20 00 0 04S P0!20 00 0 04S 0 0 00 P0!20 0P0!20 00800P0!20 00 0 040 R 0 S P0!20 00<00 0 0 P0!20 00@00 0 0 P0!20 00P0!20 00 0 040C400S* 0S 800 0R 00 8000 00  00000 000 0!0R00K [000c30K 0[0X000 T00bT0 X0000 X00X0 T0SX00SX0 T0R@000 0S/ 00!20 00 |0 x0R*5.7t{0S2 00 01 000s0!20 00C0!20 000000 0R:0S 0S 0!20 00 Tz0S 0 0KU0K-t  0K -LM 4{ -L M   0S00 K耥 -L)M M0d1 ?K`1 %=K0CX1 0P1 0t1 0h1 /00/00`1\1 X1T1 \10\1 t18#8\!0C40P10 `10 C\1Rl\!`10c00H1 P!'<0R%P10P1 P!'<0R'<0P1 `1D1 P1 100y0@1 @1S  @!H1`1 y@1`1 P100<1 <111 @10@1 @!H1X1 y@1X1 P11081 8111 @10@1 /KD1R DzH10 `100C\1 H11 X100CT1 P10 `10 C\1Rt1-00 048C8p1 p1s` =0si l= d=0S0d1 L-d10 <=0QS,= ,=0\: \ \d p!d10p1 p1S9p1S6p1,00 048C(d1R*p!<0p1 p1S p1S p1s p10cp1 p1Sf \<0S L,00T10T1 T!D<h1S h10Ch1 p1t1 t!<0p1 p1S p!;0L1 L10c1 T10L9 HI p1 0C]Sx기PT$|`lP\@$|`l , ,8,8DP\l|l\8lH$`4Tt\PDPpdXL<Pdx 8x041 41S "T10C0S T10C0X 41 0 0 0 : 41 T1 0C 41 T10C 41 40S X* x001 01S "T10C0S T10C00X: 01 0 0 0 89 01 T1 0C 01 T10C 01 00S @XJ 80ST10C h8 \80 T10C00@8 T10C000 =x0,1 ,1S`h"T10C0S T10C0yX l,1 0 0 0 0 0 0 0 7 ,1 ,!00T10C ,1 ,!00,!,10$70S ',107 ,106 00?60 ,106 ,100460ST10C 6 *60 T10C00x6 T10C000\60ST10C @6 460 T10C006 T10C000 w0(1 (1S,!T10C0S T10C0wxX (1 0 0 0 0 0 0 0 5 (1 (!00T10C (1 (!00(!(1040S $(104 (104 0040 (104 (10040ST10C x4 l40 T10C00P4 T10C000 20 $102 $100320ST10C 2 )20 T10C002 T10C000 v0 1 1S T10C0S T10C0w0X:  1 0 0 0 0 0 0 0 1 1 !00T10C 1 !00 ! 10l10S \! 10P1 10@1 00,10 101 10010ST10C 0 00 T10C000 T10C000 Tv01 1S1 T10C0S T10C0w@XJ Ԍԟ΢;|ЌČ،܌Ȍ̌Sĥ $S1 0 0 0 0 0 0 0 p0 1 !00T10C 1 !00!1000S  101 101 003(10 10<1 100(L1T P Tq4P*r1T10C!1L H HqH*rL:s :1D @ @Q@*R1< 8 8Q8*R?0K 0C  s0S T10 T10t X* s00 0S 0X: 0>K 0C s00 0S P 0S ]t@XJ 0 0 0 0 0 0 0 0 : 0 00 00 00 000L9 0L9 T10C00 0S T1 00T1 T100T100 0 T100T10 0 0L9 1s00 0S \T10C0S T10C0IX `0 0 0 0 0 0 0 0 p< 0 00 00T10C 0 000L9 @ r00 0S T10C0S T10C0X 0 0 0 0 0 0 0 0 |= 0 00 00T10C 0 000L9 r00 0S  X* 0 0 0 0 0 0 0 0 `> 0 00 00 00 000L9 tr00 0ST10C0S T10C00X: 0 0 0 0 0 0 0 0 d? 0 00 00T10C 0 000L9 1r00 0S\T10C0S T10C0r@XJ ` 0 0 0 0 0 0 0 0 ? 0 00T10C 0 00 000L9 @ q00 0SlT10C0S T10C0rX  0 0 0 0 0 0 0 0 > 0  00T10C 0 00 000L9 q00 0S`T10C0S T10C0rrX 0 0 0 0 0 0 0 0 = 0 00T10C 0 00 000L9 hq00 0ST  X* 0 0 0 0 0 0 0 0 < 0 00 00 00 00T10C 0@0L9 } +q00 0S` VT10C0S T10C0q0X: Z 0 0 0 0 0 0 0 0 ; 0 00T10C 0 00 000L9 : p00 0ST T10C0S T10C0q@XJ  0 0 0 0 0 0 0 0 : 0 00T10C 0 00 000L9 p00 0SH T10C0S T10C0lqX 0 0 0 0 0 0 0 0 9 0  00T10C 0 00 000L9 bp00 0S< T10C0S T10C0)qX 0 0 0 0 0 0 0 0 8 0  00T10C 0 00 000L9 q T10L9 m T10C T100T10C T1000T10C0L9 [ p00 0S4 X* B 0 0 0 0 0 0 0 0 \7 0 00 00 00 000L9 $ o00 0S0X: 0 0 0 0 0 0 0 0 6 0 00 00 00 00T1 0 0L9 o00 0S@XJ 0 0 0 0 0 0 0 0 5 0 00 00 00 00T1 0@0L9 [o00 0S X 0 0 0 0 0 0 0 0 4 0 00 00 00 00T1 0@0L9 q o00 0S0JX X 0 0 0 0 0 0 0 0 3 0  00 00 00 000L9 : n00 0ST X* ! 0 0 0 0 0 0 0 0 2 0 !00 00 00 000L9  n00 0Sx0X: 0 0 0 0 0 0 0 0 1 0 00 00 00 000L9  zn00 0S@XJ 0 0 0 0 0 0 0 0 1 0 00 00 00 000L9  Cn00 0SnX | 0 0 0 0 0 0 0 0 D0 0 00 00 00 000L9 ^S$ n00 0S(4X B 0 0 0 0 0 0 0 0 0 0 00 00 00 000L9 $ m00 0S X* 0 0 0 0 0 0 0 0 1 0 00 00 00 000L9  m00 0S0X: 0 0 0 0 0 0 0 0 \2 0 00 00 00 000L9  dm00 0S@XJ 0 0 0 0 0 0 0 0 83 0 00 00 00 000L9  -m00 0SXX f0 0 0 0 0 0 0 0 4 0 00 00 00 000L9 H l0|0 |0St!X /|0 0 0 0 0 0 0 0 4 |0 | 00| 00| 00| |00|0L9  l0x0 x0SP X* x0 0 0 0 0 0 0 0 5 x0 x 00x 00x 00x x00x0L9 >K 0C 0 0 0 0 0 0 0 T10C >K 0C  Dl0S T10C0T10C02mT10.m0X: T1 >K 0C0  &l0S T10(tT10C0mT10m@XJ yT10C0 mT10m +l0t0 t0SVX dt0K Lt0L9 f>K0C 0 0 0 0 0 0 T10C >K0C0  k0S T10C0|T10C0lX (T10C0l0`9 T14 0 0Q0*R0x9 T1x9 x9t9 k0p0 p0S( 0X: p0KLp0L9 >K0C 0 0 0 0 0 0 T10C >K0C0  pk0S T10C0 T10C0^l@XJ T10C0Vl0|9 T10C, ( (Q(*R09 T10C9 T1$  Q *R09 T19 Vk0l0 l0S 0X: l0KLl0L9 >K 0 0 0 0 0 0 T10C >K0  j0S T10C0 LT10C0k@XJ UT10C0kT10C9 T1  Q*R09 T19 99 j0h0 h0S| 0X: -h0Kh0L9 0'=K 0C 0 0 0 0 0 0 T1 0C '=K 0C0  j0S T1 0C0T T1 0C0k@XJ T1 0C0kT10C9 T10C  Q*R09 T10C9 T1  Q*R09 T19 j0d0 d0SL0X: d0'K Ld0L9  ij0`0 `0S T10C05k@XJ T10C0j0 `0 `00S }T10C0kX T10C0kT1 * *R:S` 00T1 `0 `0 `0 `0L9 s !j0\0 \0S LT10C0j@XJ UT10C0j0 \0 \00S \5T10C0jX >T10C0jT10C ) )R9S\ 00T10C \0 T1  Q)R\ 00T1 \0 \0L9 0@L9 HI T1L9 HI 0L9 T10C0X0 X0S T1 00T1 T100T10X0 X0 T100T10 X0 X0L9 T10L9  i0T0 T0S T10C0S T10C0\j@XJ T0 0 0 0 0 0 0 0 < T0 T 00T10C T0 T 00T T00T0L9  Ri0P0 P0S| }T1 0C0S T1 0C0jT10C0S T10C0`X wP0 0 0 0 0 0 0 0 ; P0 P 00T1 0C P0 T10C P0 P P00P0L9 U0L9 RT10C0L0 L0S T1 00T1 T100T10L0 L0 T100T10 L0 L0L9 1 h0H0 H0S X H0 0 0 0 0 0 0 0 @: H0 H  00H 00H 00H H00T10CH 0@H0L9  h0D0 D0S  X* D0 0 0 0 0 0 0 0 L9 D0 D  00D 00D 00D D00T10CD 0@D0L9 0L9 T10C0@0 @0S T1 00T1 T100T10@0 @0 T100T10 @0 @0L9  Ah0<0 <0S8lT10C0S T10C0i0X: p<0 0 0 0 0 0 0 0 7 <0 < 00T10C <0 < 00< <00<0L9 P0L9 MT10C080 80S T1 00T1 T100T1080 80 T100T10 80 80L9 , g040 40S@XJ 40 0 0 0 0 0 0 0 ,6 40 4 "004 004 004 400T10C4 0@40L9  g000 00SX 00 0 0 0 0 0 0 0 85 00 0 #000 000 000 000T10C0 0@00L9  `g0,0 ,0SX ,0 0 0 0 0 0 0 0 D4 ,0 , $00, 00, 00, ,00T10C, 0@,0L9 u #g0(0 (0SN X* \(0 0 0 0 0 0 0 0 P3 (0 ( %00( 00( 00( (00T10C (0 (0L9 90@L9 HI 4L H / L H) * 0L) H9 %0L9 "T10C0$0 $0S T1 00T1 T100T10$0 $0 T100T10 $0 $0L9  f0 0 0S0X:  0 0 0 0 0 0 0 0 1 0 &00 00 00  00T10C 0 0L9 sf00 0S@XJ 0 0 0 0 0 0 0 0 0 0  '00 00 00 00T10C 0@0L9 6f00 0S aX oꌥSѝԌ@Pԟ΢dt0 0 0 0 0 0 0 0 0 0  (00 00 00 00T10C 0 0L9 : e00 0S,X !0 0 0 0 0 0 0 0 1 0  )00 00 00 00T10C 0 0L9 L11 T10bT1 L10 \10b\1 T10T1 T1L Hp!D20p1 p1F0CT"00 048C\1 048C80t1 t1St1St1"00 0\1 0$8C8C8Qt1"0t1 :p1F0C#00 048C8t1 .h1S830 D3 Hrh1S@30SP30SZ |dd#t#000h1 t1#00 048C8p1 p1s p10p1 p1Sp1Sp1#00 048C8Sp!40p1 p1S\!`1R$ t!040LT!T10CT1 \10C\1 \1 048C8t1 p1S T10T1 T!4p1t1 0l1 0l1 0l1 40S 40s d%\1 048C((50,T!rT10CT1 \10C\1 \!`1R/K`1R `elX X:K -LM  000 0 00@e0S 00d00 000 0S0 0  0000 0 K輦 -L10!0010!0010~!0010w!0010p!00|10il!00d10bT!00L10w0,0 ( 0 >100 ,0.00 04S p>,  h>(  ,0X.00 048C8,0 ,0S0(.100 ,0.00 048C(00-00 048C8, S,0-00 048C(00-00 048C8,0 (00(0 ,0d-00 048C8S,0 -00 048C8 0 R<0(0 <0,0 ,0,00 048C8 0 =$  ( $0 c< ( 0,00( 0<(  0^SM ,   H  L T h(pH \(p<X0x(| TX0xDd,h p  !t!!!("""#X###<%l%D$D$D$D$D$D$D$D$D$D$D$D$0;0( 0:0(0 :0,0 b:0S ; :0 l*00<40 4  4 :0S : :0 n :0@b0 L: )00<40 4  4 :0S H: :0 Q ) 00>40 4  4 90S 9 90 < 90b0 9 0)00>40 4  4 T90S 9 T90  (00M?40 4  4 m90S ,9 90 90a0 8 h(00M?40 4  4 P80S 8 80 ( 00>40 4  4 ;880S d8 880 D80a0 7 '00A?40 4  4 70S 7 70 C?40 70S 7 70 -4 40040 @70S l7 @70 .4 70S 07 70 >40 4  4 60S 6 60 y I?40 60S 6 60 j C/4 40040 860S d6 860 X C/4 40040 50S 6 50 F M/4 40040 50S 5 50 4 N/4 l50S 5 l50 % N?40 4  4 v$50S P5 $50  E?40 g40S 5 40  E/4 40040 U40S 4 40 B/4 40040 CX40S 4 X40 B/4 40040 140S <4 40 E/4 40040 30S 3 30 E/4 40040 30S 3 30 F/4 40040 830S d3 830 F/4 40040 20S 3 20 F/4 20S 2 20 w G?40 x20S 2 x20 h G/4 40040 020S \2 020 V G/4 40040 10S 2 10 D G/4 40040 10S 1 10 2 .4 d10S 1 d10 # >40 4  4 t10S H1 10  F?40 4  4 b00S 1 00 G?40 4  4 P00S 0 00 G?40 4  4 >SSSSܦċγ^SSȋH00S 0 H00 >40 4  4 00S d0 00 C?40 4  4 00S 0 00   00B?40  10S 0 10 B/4 40040 h10S <1 h10 pB/4 40040 10S 1 10 ^100_0 1 B/4 40040 20S 1 20@ D"00O/4 40040 l20S @2 l20 /l"00A/4 20S 2 20 A?40 4  4 n20S 2 20 A?40 4  4 \D30S 3 D30 =40 4  4 J30S `3 30 #00I?40 4  4 530S 3 30 30^0 $4 $00K?40 H40S 4 H40 I/4 40040 40S d4 40 I/4 40040 40S 4 40 K/4 40040  50S 4 50 K/4 40040 h50S <5 h50 pJ/4 50S x5 50 aJ?40 4  4 50S 5 50 OJ?40 4  4 460S 6 460 =J?40 4  4 |60S P6 |60 +J?40 4  4 |60S 6 60 J?40 4  4 j 70S 6 70 J?40 4  4 XT70S (7 T70 T'00K?40 4  4 C70S |7 70 70]0 7 '00>40 4  4 &80S 7 80 >40 X80S ,8 X80 .4 40040 80S t8 80 (00.4 40040 80S 80$ 80a]0 09 )00-4 40040 `90S 49 `90 rM/4 90S p9 90 c)00N?40 4  4 90S 9 90 N90 ]0 4: *00=40 4  4 d:0S 8: d:0 1X:0]0 : =40 4  4 z:0 : :0S} : :0  t;0S : ;0  ;0 b\0@d+N?40 4  4 K;0S \; ;0 O?40 <;0S ; ;0 Q/4 -<0S ; <0,  O?40 4  4 H<0S < H<0p  O?40 4  4 <0S d< <0  O?40 4  4 <0S < <0 <0f\0 = =40 $=0 C0= 8=0S 4 @=0:d=00l!10b00\=0!10b0 = =0!10b00 = =0!10b000=>0 $>0 F\( $>00c0C0 T>0( 0`>0$0S t>0 |> > |>00> 0$0>0 >0 >0R!:> 0 > 0,0 ,]00 >0$0 0S ?0 $? ,?0(0 0,0 kD?0(0 U0 0 R 00S0 0 R N|? '0S ? ? ?0 C?00S0 0 ?0S6?01? 0 0 0,0 x00(0 p00$0 .d00 \00 D0 0,0 000(0 (00$0 ~${ 40K訋 -Lpp@-̌ J"Z 4 5\ @D VK &R""#,4 R!\dUV@L* c0`VP c0ǠV`F P! ! c0V`F P!! c0V`F P!,! c0V`F P!! R&^b!.1,°T \JUV p @ Pt p@T:8"Z 4 5 4F 5 5Vm ``M@xPc{  01p0PQQ!1ƑƓ   0@-PpC--3#---3# & * Z>>*S 51:3`@-@0s@DP- -L[Q::15546/usr/local/etc/dhcp6c.conf/var/run/dhcp6c.pid/usr/local/etc/dhcp6cctlkeymainc:drswxPSDfik:p:failed to initialize %sfailed to parse configuration filedaemonw%d usage: dhcp6c [-c configfile] [-drsxDfi] [-p pid-file] interface [interfaces...] -s : dhcpv6 server -r : radvd -x : XS4ALL get_sduidrfailed to open DUID file: %sDUID file corruptedfailed to allocate memoryextracted an existing DUID from %s: %sget_iafailed to open IA file: %sIA file corruptedextracted an existing IA from %s: IA_PD: ID=%lu, T1=%lu, T2=%luget_prefixfailed to open prefix file: %sprefix file corruptedextracted an existing prefix from %s: IA_PD prefix: %s/%d pltime=%lu vltime=%luclient6_initfailed to get a DUID-LL/etc/dhcp6/dhcp6c_duidfailed to get a DUID-LLTfailed initialize control message authentication/etc/dhcp6/dhcp6c_sduidfailed to get a server DUID/etc/dhcp6/dhcp6c_iafailed to get a client IA/etc/dhcp6/dhcp6c_pdfailed to get a client prefix546getaddrinfo: %ssocketsetsockopt(SO_REUSEPORT): %ssetsockopt(IPV6_RECVPKTINFO): %ssetsockopt(sock, IPV6_MULTICAST_LOOP): %ssetsockopt(IPV6_V6ONLY): %sbind: %sopen a routing socket: %sff02::1:2547skip opening control portfailed to initialize control channelfailed to set signal: %sclient6_startremoved existing timer on %sfailed to create an eventfailed to allocate authentication parametersfailed to add a timer for %sclient6_startallfailed to reset %scheck_exitexitingprocess_signalsrestartingclient6_mainloopselect: %sclient6_do_ctlcommandassumption failure: command length mismatchfailed to get current time: %stimestamp is out of rangeno secret key for control channelauthentication failureunsupported version: %dinvalid command length for reload: %dunknown start target: %ulunknown control command: %d (len=%d)client6_reloadfailed to reload configuration fileclient reloadedclient6_ifctlfailed to find interface configuration for %sstartstop%s interface %sfailed to restart %sunknown command: %dclient6_expire_refreshtimeinformation refresh time on %s expiredclient6_timono responses were receivedcan't send solicitall information to be updated was canceledcan't find a servercan't copy server IDfailed to construct request dataconstruct_confdatafailed to create a new event dataNEW IAID (%x) is generatedIAID (%x) is generatedinternal errorconstruct_reqdatadestruct_iadataassumption failure %dselect_serverpicked a server (ID: %s)client6_send_releasea new XID (%x) is generatedfailed to copy server IDfailed to copy client IDfailed to construct optionstransmit failed: %ssend %s to %sclient6_sendunexpected statefailed to copy requested optionsfailed to add an IAPDunexpected event data (%d)failed to set authentication optionfailed to calculate MACNetwork is unreachableclient6_recvrecvmsg: %sfailed to get packet infounexpected interface (%d)short packet (%d bytes)receive %s from %s on %sfailed to parse optionsreceived an unexpected message (%s) from %ssave_sduidw+failed to save server DUIDsaved generated server DUID to %sclient6_recvadvertXID mismatchno server ID optionserver ID: %s, pref=%dno client ID optionclient DUID mismatchfailed to process authenticationNoPrefixAvailNoAddrsAvailadvertise contains %s statusunexpected advertiseduplicated server (ID: %s)memory allocation failed for servermemory allocation failed for authentication parametersfailed to copy optionsreset timer for %s to %d.%06dclient6_recvreplyunexpected replyno rapid commitstatus code: %snameserver[%d] %sDomain search list[%d] %sNTP server[%d] %sSIP server address[%d] %sSIP domain name[%d] %sfailed to add timer for refresh timerefresh time is too large: %luunexpected information refresh time option (ignored)mv /etc/dhcp6/dhcp6c_pf /etc/dhcp6/dhcp6c_pf.oldexecutes %s, state=%dgot an expected reply, sleeping.process_authserver did not include authentication informationunknown authentication algorithm (%d)unknown RDM (%d)previous RD value is unknown (accept it)possible replay attack detectedauthentication key mismatchfailed to find key provided by the server (ID: %x)found key for authentication: %skey %s has expiredmessage authentication validatedinvalid message authenticationserver sent unsupported authentication protocol (%d)message not authenticated while authentication requiredset_authdelayed authentication cannot be used for Information-request yetno authentication key for %skey %s is invalidfailed to get a replay detection valuefailed to allocate memory for authentication realmunsupported authentication protocol %dinfo_printf%sdhcp6_add_listvalfailed to allocate memory for list entryunexpected list value type (%d)dhcp6_get_addrmalformed DHCP option: type %d, len %dduplicated %s address (%s)failed to copy %s addressdhcp6_set_addrmemory allocation failed for %s optionsdhcp6_get_domainfailed to decode a %s domain namefailed to copy a %s domain namedhcp6_set_domainmemory allocation failed for %s domain optionsfailed to encode a %s domain namebuffer length for %s domain name is too shortdhcp6_create_eventfailed to allocate memory for an eventdhcp6_remove_eventremoving an event on %s, state=%sremoving server (ID: %s)dhcp6_auth_replaycheckunsupported replay detection method (%d)previous: %s, current: %sdetected a singular pointffff ffff ffff ffffgetifaddrgetifaddrs failed: %sgetifidfromaddrif_nametoindex failed for %sget_duidllfailed to get a hardware addressfailed to allocate memorygenerated a new DUID-LL: %s %dget_duidrfailed to open DUID file: %sDUID file corruptedextracted an existing DUID from %s: %sgenerated a new DUID-LLT: %s %dw+failed to open DUID file for savefailed to save DUIDsaved generated DUID to %s/etc/dhcp6/dhcp6c_dbDUID: %s failed to open /etc/dhcp6/dhcp6c_duid for savegethwidfound an interface %s for DUIDsave_iafailed to open IA file: %sfailed to save IA contentsaved IA to %ssave_prefixfailed to open prefix file: %sfailed to save prefix contentsaved prefix to %sdhcp6_get_optionsget DHCP option %s, len %dmalformed DHCP options DUID: %sfailed to copy DUID status code: %sfailed to copy status code requested option: %sduplicated option type (%s)failed to copy requested option preference: %dduplicated preference option elapsed time: %luduplicated elapsed time optionfound more than one authentication option %sfailed allocate memory for auth realm auth key ID: %x, offset=%d, realmlen=%dunsupported authentication protocol: %d IA_PD: ID=%lu, T1=%lu, T2=%luduplicated IA_PD %lu/etc/dhcp6/dhcp6c_ia information refresh time: %lurefresh time is too small (%d), adjustedduplicated refresh time option IA_NA: ID=%lu, T1=%lu, T2=%luduplicated IA_NA %luunknown or unexpected DHCP6 option %s, len %d.%ccopyin_optionmalformed DHCP option%s is an invalid position for %sinvalid prefix length (%d) IA_PD prefix: %s/%d pltime=%lu vltime=%luduplicated IA_PD prefix %s/%d pltime=%lu vltime=%lu/etc/dhcp6/dhcp6c_pd IA_NA address: %s pltime=%lu vltime=%luduplicated IA_NA address%s pltime=%lu vltime=%luduplicated status code (%d) malformed DHCP option: type %d%04x %04x %04x %04xdelayedreconfigunknown(%d)HMAC-MD5mono counterproto: %s, alg: %s, RDM: %s, RD: %sunknown(255)copy_optionoption buffer short for %sset %s (len %d)dhcp6_set_optionsfailed to count option lengthshort buffermemory allocation failed for IA_NA optionsfailed to construct an IA_NA optionmemory allocation failed for optionsrefresh time option is not requested for %smemory allocation failed for IA_PD optionsfailed to construct an IA_PD optionunexpected authentication protocolfailed to allocate memory for authentication informationkey ID %x, offset %dcopyout_optionunknown option: code %dset %sdhcp6_set_timeoparamunexpected event state %d on %sdhcp6_reset_timerreset a timer on %s, state=%s, timeo=%d, retrans=%dduidcpymemory allocation failedget_rdvalueunsupported RDM (%d)unsupported RD size (%d)gettimeofday failed: %sINVALID optionclient IDserver IDidentity associationIA for temporaryIA addressoption requestpreferenceelapsed timerelay messageauthenticationserver unicaststatus coderapid commituser classvendor classvendor specific infointerface IDreconfigure messageSIP domain nameSIP server addressDNSdomain search listNTP serverIA_PDIA_PD prefixinformation refresh timeNIS serversNIS+ serversNIS domain nameNIS+ domain nameBCMCS domain nameBCMCS server addressGeoconf Civicremote IDsubscriber IDclient FQDNopt_%dINVALID msgsolicitadvertiserequestconfirmrenewrebindreplyreleasedeclinereconfigureinformation requestrelay-forwardrelay-replymsg%dINVALID codesuccessunspec failureno addressesno bindingnot on-linkuse multicastno prefixescode%d:%s%02x%s...INITSOLICITINFOREQREQUESTRENEWREBINDRELEASEIDLE???JanFebMarAprMayJunJulAugSepOctNovDecwwwwwwwwwwww: %3s/%02d/%04d %02d:%02d:%02d: %s%s%s %s%s%sifaddrconfaddremovecan't open a temporary socket: %sfailed to get the index of %s: %sfailed to %s an address on %s: %s%s an address %s/%d on %ssafefilesetuid'ed execution not allowedlstat failed: %s%s has invalid owner uid%s is an invalid file type 0x%oconfigure_interfaceinvalid interface(%s): %smemory allocation for %s failedfailed to copy ifname%s:%d client-only configuration%s:%d server-only configuration%s:%d bad value: %d%s:%d duplicated configurationfailed to copy script pathscript must be an absolute path%s:%d pool '%s' not found%s:%d specified a larger preferred lifetime than valid lifetimememory allocation failedpool '%s' is specified to the interface '%s'%s:%d invalid interface configurationconfigure_iainternal errormemory allocation for IA %s failedIAPDfailed to configure prefix%s:%d invalid configurationIANAfailed to configure address%s:%d invalid iatype %dadd_pd_pif%s:%d duplicated prefix interface: %s%s:%d invalid interface (%s): %sfailed to get default IF ID for %s%s:%d invalid SLA length: %d%s:%d internal error: invalid configurationconfigure_hostmemory allocation failed for host %sfailed to copy host name: %s%s:%d duplicated DUID for %s%s:%d failed to configure DUID for %sconfigure DUID for %s: %sfailed to configure prefix for %sfailed to configure address for %s%s:%d: duplicate key %s for %s (ignored)failed to find key information for %sconfigure key for delayed auth with %s (keyid=%08x)pool '%s' is specified to the host '%s'%s:%d invalid host configuration for %sconfigure_keysmemory allocation failed for key %sfailed to copy key name: %s%s:%d duplicate realm for key %s (ignored)failed to allocate memory for realm%s:%d key ID overflow%s:%d duplicate secret for key %s (ignored)failed to make a copy of secret%s:%d failed to parse base64 keyfailed to allocate memory for secret%s:%d duplicate expire for key %s (ignored)%s:%d invalid key parameter for %srealm not specified for key %skey ID not specified for key %ssecret not specified for key %sforevercannot get current time: %s%Y-%m-%d %H:%M%m-%d %H:%M%H:%Minvalid expiration time: %spast expiration time specified: %sconfigure_authinfomemory allocation failed for auth info %sfailed to copy auth info name: %s%s:%d duplicate protocol for auth info %s (ignored)%s:%d duplicate algorithm for auth info %s (ignored)%s:%d duplicate RDM for auth info %s (ignored)%s:%d auth info specific keys are not supported%s:%d invalid auth info parameter for %sauth protocol is not specified for %sclient-only auth protocol is specifiedserver-only auth protocol is specifiedSIPDNSNTPNISNISPBCMCSconfigure_addr%s:%d duplicated %s server: %sfailed to add a %s serverconfigure_domainfailed to copy a %s domain name%s:%d duplicated %s name: %sfailed to add a %s nameconfigure_duidtoo long DUID (%d)%02xassumption failure (bad string)get_default_ifidID length too shortgetifaddrs failed: %slink layer address is too short (%s)cannot find interface information for %sconfigure_commitsome IA configuration defined but not usedclear_iaconfassumption failureadd_optionsinvalid operation (%d) for option type (%d)%s:%d auth info (%s) is not defined%s:%d authinfo is doubly specified on %s%s:%d IA_PD (%lu) is not defined%s:%d IA_NA (%lu) is not definedduplicated requested option: %sfailed to configure an option%s:%d unsupported option type: %dadd_prefixinvalid prefix: %dprefix %s/%d for %s has a trailing garbage. It should be %s/%dinvalid prefix address: %sduplicated prefix: %s/%d for %sduplicated address: %s for %s%s/%d has larger preferred lifetime than valid lifetime%s has larger preferred lifetime than valid lifetimeconfigure_poolcalled%s:%d pool statement is server-only%s:%d invalid pool configuration%s:%d pool '%s' has no range declarationfaled to craete pool '%s'clear_poolconfcreate_dynamic_hostconfreached to the max count (count=%lu)???created host_conf (name=%s)create_poolname=%s, range=%s->%sinvalid address range %s->%sfind_poolname=%sfound (name=%s)not found (name=%s)get_free_address_from_poolcalled (pool=%s)found %snext address %sno available addressis_available_in_poolpool=%s, addr=%sunavailable address (pool=%s, addr=%s)update_prefixinvalid prefix %s/%d: pltime (%lu) is larger than vltime (%lu)memory allocation failedcreateupdate%s a prefix %s/%d pltime=%lu, vltime=%luskip %s as a prefix interfacefailed to add prefix timerremove_siteprefixremove a site prefix %s/%drenew_data_freeassumption failuresiteprefix_timoprefix timeout for %s/%dclient6_pf2file/etc/dhcp6/dhcp6c_pfa+failed to open /etc/dhcp6/dhcp6c_conf for save%s-prefix %s/%d %s-addr %s/%d add_ifprefixfailed to allocate memory for ifprefixassumption failure on the length of interface IDinvalid prefix length %d + %d + %dupdate_iainvalid IA: T1(%lu) > T2(%lu)failed to get an IA type: %s, ID: %ufailed to update authentication param for IA type: %s, ID: %ufailed to update a prefix %s/%dfailed to update an address %sstatus code for %s-%lu: %sreceive NoBinding against renew/rebind for %s-%luimpossible caseIA %s-%lu is invalidatedT1(%lu) and/or T2(%lu) is locally determinedT1 (%lu) or T2 (%lu) is too small adjusted to %lu and %lufailed to add IA timerupdate_authparamfailed to copy authparamreestablish_iare-establishing IA: %s-%luinternal error (invalid IA status)failed to create a new eventfailed to create a new event timerfailed to create a new event datafailed to copy server IDfailed to make reestablish datacallbackrelease_iarelease an IA: %s-%lufailed to make release dataremove_iaremove an IA: %s-%luia_timoIA timeout for %s-%lu, state=%sinvalid IA state (%d)failed to make renew datafailed to make rebind dataget_iamemory allocation failedmakeupdate%s an IA: %s-%luPDNA???ACTIVERENEWREBINDdhcp6_add_timercan't allocate memorytimeout function unspecifieddhcp6_timer_resta timer must be expired, but not yetclient6_scriptreason=BOUND6reason=RENEW6reason=REBIND6reason=RELEASE6Impossible condition at %s:%ddhcp6c_script.cmv /etc/dhcp6/dhcp6c_conf /etc/dhcp6/dhcp6c_conf.oldfailed to allocate environment bufferfailed to allocate reason stringsfailed to allocate strings for DNS servers%s= failed to allocate strings for NTP serversfailed to allocate strings for DNS namefailed to allocate strings for SIP serversfailed to allocate strings for SIP domain namefailed to allocate strings for NIS serversfailed to allocate strings for NIS domain namefailed to allocate strings for NIS+ serversfailed to allocate strings for NIS+ domain namefailed to allocate strings for BCMC serversfailed to allocate strings for BCMC domain namefailed to fork: %swait: %sscript "%s" terminated===> env start%s===> env endscript "%s" cannot be executed safely/dev/nullchild: exec failed: %sclient6_start_server/tmp/dhcp6c_radvd/tmp/dhcp6c_6stype=%d, path=%srfailed to open %sfail to read %secho start radvdradvd -C /etc/dhcp6/dhcp6c_radvd.conf -m stderr_syslog -p /var/run/radvd.pidecho start dhcp6sclient6_conf2file/etc/dhcp6/dhcp6c_confa+failed to open /etc/dhcp6/dhcp6c_conf for save%s %s %d client6_iapd2str%s%s/%d,%s#%dimpossible suboptfailed to allocate iapd_%dclient6_iana2str%s%sfailed to allocate iana_%difinitduplicated interface: %smalloc failedfailed to copy ifnamegetifaddrs failed: %sifresetinvalid interface(%s): %sABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=dhcp6_ctl_initgetaddrinfo: %ssocket(control sock): %ssetsockopt(control sock, SO_REUSEADDR: %sbind(control sock): %slisten(control sock): %sinvalid maximum number of commands (%d)dhcp6_ctl_authinitrfailed to open %s: %sfailed to read key file: %sfailed to decode base64 stringfailed to allocate control keyfailed to allocate secret keydhcp6_ctl_acceptcommandfailed to accept control connection: %saccept control connection from %scommand queue is not initializedfailed to allocate new command contextcommand queue is full. drop the oldest one (fd=%d)dhcp6_ctl_closecommandassumption error: command queue is empty?dhcp6_ctl_readcommandread failed: %scontrol channel was reset by peertoo large command (%d bytes)update_addressinvalid address %s: pltime (%lu) is larger than vltime (%lu)memory allocation failedcreateupdate%s an address %s pltime=%lu, vltime=%lufailed to add stateful addr timerremove_addrremove an address %sna_renew_data_freeassumption failureaddr_timoaddress timeout for %slease_initcalledlease_addressaddr=%salready leased: %srelease_addressnot found: %sdecline_addressgetifaddrsifa_data_ptr <= (char *) &ifas[newlink + newaddr] + ifa_data_size./linux/getifaddrs.c  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGGHHHHHHHHIJKKKKKKKKKKKKLLLLMNOPQQRSSTTTTTTTTTTTTUUVVVVVVVVVVVVVVVVWXXYYZZ[[\\]]^__``aabccddddeefghhiiii """"""%NW%Zd% NW$#&OPX[e5;<=>9:?@ABCD3)  `abc!MLF,786('*.+/01J2-SQY\]^_fghiG4EKHTIRUV .F>b|@ghBlRsSyhh@whhhhhhhhhhhhh h"h$()*%h+h,hh.78:;<hhhhhhJhhhhhhhhhhhhhh!c?tA>=BDCHhyMHhhNh\us`dhbiex{h}~zhhhhhhhhhhhhhrhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhghajhihhhhhhhhhhhhdd)C޴DE+$jjTtuv&wUVWXYH%ZEx0'24(6J8E[\]* /1e ff,kno^_LpqEN`-EaUVWXYP3ZE{r5=79:; A -D <)*12375 >4A@&B? >"0A#$%?6B<@@;CC@?@@'( 8 :>./A>@?AC >BAA@B>BB?????>#$% >>>>><A>B>8A:A#$%A@>>C !">8 : ,+A>@B<CB !"-<E&>B>><>X>>>>>>9>>=?j>>>>f>>>>>>>>><<<AA>>>?G &06;HIJKLMNOP  !"-47B? ? ??QBQS?\?aS>AR>>>>>>>>>>>chS #$%8:@CT\@C]^a @b@'(./@d1235@i@AX  !"&UVUV<>BAAWAZ>AY@>Y@X>>)*e+f,gA>B><<->E>>>>>>9>[>=>>?>>>>>>>>>>>[UA[<_[@`[<<>>>Deletingcan't allocate memoryrefresh time is out of rangerefresh time is too small (must not be smaller than %d)multiple refresh times (ignored)0invalid IPv6 address: %ssyntax errorError: discardingError: poppingmemory exhaustedCleanup: discarding lookaheadCleanup: poppingduplicated name: %s (ignored)RQGHQILPPKJMNOPPPPPPPPPPPPPPPJPP*PP+111>>>QQGFIPJPJPPPPPPPPPPPPPPPPPPPPPPPPPPPP*P*)(1111>>>>BEPPPPPPPPPPPPPPPPP5PPPPPPPPP4PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP&PPPPPPPPPPPP@PPPPPPPPPPP?PPPPPPPPPPPPPPPPCPPPPPPPPPPPPPPP PPPPP AP-PP; PPP6PP:PDPPP=PPPPPPPPPPPPP.9PPPPPP8'/PPPPPPPPPP2P7PPP3PPPPPPPPPPPPPPPPPPP PPPPPPPP PPPPPPPP<PPPPPP"PPPPPPPPPPPPPPPPPPPPPPPPPP0PPPPPPPPPPPPPPPPPPPPPPPPPPPP%PPPP,PPPPPPPPPPPPPPPPPPPPPPP PPPPPPPPP#PP$!  !"#$%&'()*+,-..Jq :h   ),B5FGJLuNyZ})G{vaX ~6e\Z]\IRDiQS5=8M:/3+2#0*&+*! ('%4 & % ~{stklebf`cok``fg\\cZZaXb^RZNELA=BG:I=D;C4C?6,(:58+:54/&50"%( sfW                           <                                                                                                                                                                                                                                                                                                                                                                                                                                !"##$SS>??TUUWattb[X_>`??c\iY@jA]%&B!"##@$AfkxxlmnoBgpuqvvyzzR||}}w%&'()*+,-.s/0123457"88~$RSSSSTUUtt%&7"88$ttuvvxxxxyzzTUU}}}}~%&:";;$%&:";;$%&<<==========D"EE$%&D"EE$%&G"HH$~}|{zyxwv%&uG"HHt$srqponmlkjihgfedcba`_^]\[ZYXWVU%&TK"LLS$RQPONMLKJIHGFEDCBA@?>=<;:987654%&3K"LL2$10/.-,+*)('&%$#"! %&T{{||||  ||||||               666999CCCFFFJJJOOOQQPNrhed^ZVPNMMII!! ###(-77-*(,,-*2( 2 * 03::334X40X48488;;;===>>DDccGGco???EoEEH HHKKLLLSSTTUjUUkkttjmmuumvvvxxyyzmzz{{{{}}~~     ~}{zyxwvutsrqponlkjihfedb`_^]\[ZYXWSRQPONKIHGFEDCBA@?><;:86543210.-+('&%$#"      <<<<<<<<<<<<<           |qpnlihgfedba`_^]\[ZYWVONMIA@51/.+)'begin of closure****commentend of sentenceend of closurefatal flex scanner internal error--no action foundfatal flex scanner internal error--end of buffer missedfatal error - scanner input buffer overflowinput in flex scanner failedout of dynamic memory in yy_create_buffer()out of dynamic memory in yy_scan_buffer()out of dynamic memory in yy_scan_bytes()bad buffer in yy_scan_bytes()%s cfdebug_print<%d>%s [%s] (%d)<%d>[%s] (%d)yyerror0%s %d: cfswitch_buffercfparse: includes nested too deeplyrcfparse: fopen(%s): %scfparsefatal parse failure: exiting (%d errors)fatal parse failure: exiting/dev/urandomp RTT  P܏8oooڎP P0R4R